PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10005740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 280aa    MW: 31484 Da    PI: 5.0302
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10005740genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding408.9e-131357145
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     rg W++eEd++l  ++ + G g+W+t++   g+ R +k+c++rw 
      Lus10005740 13 RGLWSPEEDDRLRSYIVRNGHGCWTTVPINAGLQRNGKSCRLRWI 57
                     788*****************************************6 PP

2Myb_DNA-binding44.73.1e-1466111148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg +++ E++ ++ +++ lG++ W+ Iar ++ gRt++++k++w++yl
      Lus10005740  66 RGLFSANEEDTILTLHRFLGNK-WSQIARNLP-GRTDNEIKNYWHSYL 111
                      67899*****************.*********.************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.5E-19663IPR009057Homeodomain-like
PROSITE profilePS5129416.191860IPR017930Myb domain
SuperFamilySSF466891.17E-2510107IPR009057Homeodomain-like
SMARTSM007178.3E-81262IPR001005SANT/Myb domain
PfamPF002497.7E-111357IPR001005SANT/Myb domain
CDDcd001676.46E-71660No hitNo description
PROSITE profilePS5129423.6461115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2264115IPR009057Homeodomain-like
SMARTSM007174.1E-1365113IPR001005SANT/Myb domain
PfamPF002491.5E-1266111IPR001005SANT/Myb domain
CDDcd001671.62E-969111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MEECKDQKPK LRRGLWSPEE DDRLRSYIVR NGHGCWTTVP INAGLQRNGK SCRLRWIIYL  60
RPGLKRGLFS ANEEDTILTL HRFLGNKWSQ IARNLPGRTD NEIKNYWHSY LKRKILKPQQ  120
CASSSSLTES SSPLSRNRRE ESVPPISTVV ADQSYYNNST VGLDDYVSSR PLLPPNLMFS  180
EWLSMDGSAS TTSAAEVLFP DEGFACGSDE FSIDIPSSEF LGEHLFQGYD LNSTTMSDGS  240
GSDILSSQFD FGDRSLDGAD QFVGFYSDFH LNMDSVVYI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-2291153108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1744470.0JX174447.1 Linum usitatissimum clone LuBAC375N24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010107436.15e-73Transcription factor LAF1
TrEMBLW9RWY95e-73W9RWY9_9R
STRINGPOPTR_0015s13190.16e-71(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38303161
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.12e-59myb domain protein 18